Sale!

artecpro2functioncommercialstyleprerinsekitchenfaucetwithpulldownspringspoutandpotfillerwithsoapdispenserkrausdiscoverthelatestfashiontrendsandbeginshopping0.jpg

Artec Pro 2-Function Commercial-Style Pre-Rinse Kitchen Faucet with Pull Down Spring Spout and Pot Filler with Soap Dispenser Kraus

$ 127,84

Description
shopping

Transform your kitchen with the sleek professional look of the Kraus Artec Pro commercial-style kitchen faucet, featuring a striking high-arc open coil spout with an industrial aesthetic. The versatile design includes a pre-rinse sprayer for blasting away tough food residue and a rotating pot filler that allows you to quickly fill up your largest pots and tallest pitchers. Magnetic docking snaps the spray head securely into place, offering maximum efficiency for everyday tasks.

Flow rate: 1.8 gpm
Material: Brass
Finish: Spot Free Antique Champagne Bronze
Sprayer function: Spray
Spout Type: High Arc
Durable all-metal construction with a metal body and stainless steel spring spout
Spot free antique champagne bronze finish prevents water spots and fingerprints for a cleaner faucet, creates a high-end modern look
Includes matching soap dispenser
2-function faucet: switch between pot filler and pre-rinse sprayer for a variety of kitchen tasks
Rotatable pot filler provides soft aerated stream to easily fill large pots and pitchers, anti-clogging aerator ensures optimal splash-free performance
High-arc spout with pre-rinse sprayer: blast away tough residue using the powerful spray function
Easy-clean nozzles: soft rubber spray holes allow you to easily wipe away mineral build-up for long-lasting performance
Magnetic docking: spray head snaps into place for a secure hold
Smart handle design: single handle operates with 100 degrees forward rotation, allowing for installation in tighter spaces with no backsplash clearance needed
Easy installation with QuickConnect allows you to effortlessly attach water supply lines with out any need to hand-tighten
Premium ceramic cartridge provides long-lasting leak-free use
Installation ready: water supply lines and all mounting hardware included
Dimensions: faucet height: 24-3/4″, spout height: 6-5/8″, spout reach 7-5/8″, sprayer height 11-1/4″, sprayer reach 7 1/8 in.

Professionally packed and fast shipping

Because of our long-standing partnership in a long-standing partnership with UPS, FedEx, DHL and many other world-class carriers, we can provide various shipping options. Our warehouse personnel is highly-skilled and will pack your products in accordance with our exact and accurate specifications. Before shipment, all items are carefully examined and secured. Everyday, we send to thousands of customers in multiple countries. This is a sign of our determination to be the largest online retailer on the planet. Warehouses and distribution centers are found in Europe and the USA.

Note: Orders that contain more than one product are assigned a specific processing time, based on the individual item.

Before shipping We will examine thoroughly the items you have ordered. The majority of orders will be sent within 48 hours. The delivery time is between 3-7 working days.

Returns

The stock is dynamic and we cannot fully manage it due to the fact that many parties are involved, which includes our factory and warehouse. The actual inventory can fluctuate at any time. It is possible that the stocks could be depleted after your order has been processed.

The policy is for 30 days. Unfortunately, if 30 days have passed after you bought your item, we will not be able to provide a refund or exchange.

To be eligible for a return your product must be unopened and in the same condition as you received it. The item must be in its original packaging.

Artec Pro 2-Function Commercial-Style Pre-Rinse Kitchen Faucet with Pull Down Spring Spout and Pot Filler with Soap Dispenser Kraus

Related products

Login