Sale!

wetakeprideintreatingeachandeverycustomerweserveasiftheywerefamilyweenjoyhelpingpeoplediscoverthe48squareoutdoorwoodraisedgardenbedbrownsunnydazedecor0.jpg

48″ Square Outdoor Wood Raised Garden Bed – Brown Sunnydaze Decor

$ 44,98

SKU: mode_7350840164548 Category: Planters Tags: brand_sunnydaze_decor, cat_lawn_&_garden, Color Family:Brown, Finish:Light Brown, In_Stock, Material:Fir, MPN_HB-710, No_Expediting, Not_On_Sale, NounModifier_Outdoor_Planter, pro_8275, prodid_1190741, RBHLive, sbcat_planters, spcat_outdoor, Style:Contemporary, Visible

Description
shopping

Grow a variety of plants, vegetables, flowers, or herbs with this elegant, outdoor, square, wooden raised garden bed or planter box. This outdoor planter is made from durable yet elegant fir wood for a stylish look that is sure to complement your patio, front porch, balcony, or garden aesthetic while uplifting your existing decor. The wood is durable for long-lasting use when placed outdoors. Make sure to cover it or bring it indoors in freezing weather for ensured longevity. This planter box or garden bed is the perfect way to add a sophisticated style to the backyard or garden while beautifully ensuring proper growth from your plants. Plus, assembly is simple. All of the necessary tools, hardware, and components for assembly are included in the box. This wooden planter box also has enough space to grow multiple plants at the same time, sure to bring bright, beautiful blossoms to your home with ease. Light up your backyard or garden with this raised bed and watch your plants flourish effortlessly.

Dimensions: 48″ L x 48″ W x 12.25″ H
Weight: 18 lbs
Color: Light Brown
Materials: Fir
Made in China
Care: Wipe down surfaces with clean water and a mild soap/vinegar and a soft, non-abrasive cloth. Do not use metal brushes or tools that will scratch the surface. Be sure all of the soap residue has been wiped away. Dry unit by hand or air-dry.

Professionally packed and fast shipping

Because of our long-standing partnership in a long-standing partnership with UPS, FedEx, DHL and many other world-class carriers, we can provide various shipping options. Our warehouse personnel is highly-skilled and will pack your products in accordance with our exact and accurate specifications. Before shipment, all items are carefully examined and secured. Everyday, we send to thousands of customers in multiple countries. This is a sign of our determination to be the largest online retailer on the planet. Warehouses and distribution centers are found in Europe and the USA.

Note: Orders that contain more than one product are assigned a specific processing time, based on the individual item.

Before shipping We will examine thoroughly the items you have ordered. The majority of orders will be sent within 48 hours. The delivery time is between 3-7 working days.

Returns

The stock is dynamic and we cannot fully manage it due to the fact that many parties are involved, which includes our factory and warehouse. The actual inventory can fluctuate at any time. It is possible that the stocks could be depleted after your order has been processed.

The policy is for 30 days. Unfortunately, if 30 days have passed after you bought your item, we will not be able to provide a refund or exchange.

To be eligible for a return your product must be unopened and in the same condition as you received it. The item must be in its original packaging.

48″ Square Outdoor Wood Raised Garden Bed – Brown Sunnydaze Decor

Related products

Login