Sale!

wetakeprideintreatingeachandeverycustomerweserveasiftheywerefamilyweenjoyhelpingpeoplediscovertheeiffeltowercollection9piedishwhitelecreuset0.jpg

Eiffel Tower Collection 9″ Pie Dish – White Le Creuset

$ 28,00

SKU: mode_7219249152196 Category: Pie Pans Tags: brand_le_creuset, cat_bakeware, Color Family:White, Finish:White, Holiday_Prep, In_Stock, Material:Stoneware, MPN_PG6109E-0916, No_Expediting, Not_On_Sale, NounModifier_Pie_Dish, pro_5152, prodid_1142632, RBHLive, sbcat_pie_pans, spcat_kitchen, Style:Contemporary, Style:Traditional, Style:Transitional, Visible

Description
shopping

The Eiffel Tower Pie Dish features an elegant, embossed relief of one of the most iconic monuments in France. The motif is revealed in the bottom of the dish as pieces are served to bring a touch of chic Parisian charm to the table. Crafted from premium stoneware to ensure perfectly golden brown crusts, the Pie Dish is finished with a beautiful glaze which is easy to clean, dishwasher-safe, and resistant to chips, scratches and stains.

For culinary inspiration, explore Le Creuset recipes for delicious dishes to try with your new cookware.

Learn more about the materials that make Le Creuset a trusted name in cookware along with a guide to proper care and usage.

Material: Stoneware
Color: White
Premium stoneware ensures excellent heat distribution for uniform browning and even cooking with no hot spots
Superior heat retention keeps food warm or cold for serving
Colorful glaze is nonporous, non-reactive, scratch-resistant, and resists stains and flavor absorption
Smooth interior enamel easily releases food for quick clean-up, and resists cracking and crazing
Unmatched thermal resistance for temperatures ranging from -9 degrees F to 500 degrees F
Safe for freezer, oven, microwave, broiler, dishwasher, and metal utensils
Heat source: broiler, oven, microwave
Dishwasher Safe
Made in Thailand
10-year warranty

Professionally packed and fast shipping

Because of our long-standing partnership in a long-standing partnership with UPS, FedEx, DHL and many other world-class carriers, we can provide various shipping options. Our warehouse personnel is highly-skilled and will pack your products in accordance with our exact and accurate specifications. Before shipment, all items are carefully examined and secured. Everyday, we send to thousands of customers in multiple countries. This is a sign of our determination to be the largest online retailer on the planet. Warehouses and distribution centers are found in Europe and the USA.

Note: Orders that contain more than one product are assigned a specific processing time, based on the individual item.

Before shipping We will examine thoroughly the items you have ordered. The majority of orders will be sent within 48 hours. The delivery time is between 3-7 working days.

Returns

The stock is dynamic and we cannot fully manage it due to the fact that many parties are involved, which includes our factory and warehouse. The actual inventory can fluctuate at any time. It is possible that the stocks could be depleted after your order has been processed.

The policy is for 30 days. Unfortunately, if 30 days have passed after you bought your item, we will not be able to provide a refund or exchange.

To be eligible for a return your product must be unopened and in the same condition as you received it. The item must be in its original packaging.

Eiffel Tower Collection 9″ Pie Dish – White Le Creuset

Related products

Login